PDB entry 1ayd

View 1ayd on RCSB PDB site
Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
Deposited on 1994-05-15, released 1994-08-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1ayd__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ayd_ (-)
  mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
  ydlyggekfatlaelvqyymehhgqlkekngdvielkypln