PDB entry 1ayb

View 1ayb on RCSB PDB site
Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
Class: hydrolase(sh2 domain)
Keywords: hydrolase(sh2 domain)
Deposited on 1994-05-15, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.164
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase syp (n-terminal sh2 domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ayba_
  • Chain 'P':
    Compound: peptide irs-1-895
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1aybA (A:)
mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkypln

    Sequence, based on observed residues (ATOM records): (download) 
    >1aybA (A:)
rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy
dlyggekfatlaelvqyymehhgqlkekngdvielkypln

  • Chain 'P':
    No sequence available.