PDB entry 1aya

View 1aya on RCSB PDB site
Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
Deposited on 1994-05-15, released 1994-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.05 Å
R-factor: 0.18
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ayaa_
  • Chain 'B':
    Domains in SCOP 1.57: d1ayab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ayaA (A:)
mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkypln

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ayaB (B:)
mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkypln