PDB entry 1aya

View 1aya on RCSB PDB site
Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
Class: hydrolase(sh2 domain)
Keywords: hydrolase(sh2 domain)
Deposited on 1994-05-15, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein-tyrosine phosphatase syp (n-terminal sh2 domain)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35235 (1-100)
  Domains in SCOPe 2.08: d1ayaa_
• Chain 'B':
  Compound: protein-tyrosine phosphatase syp (n-terminal sh2 domain)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35235 (1-100)
  Domains in SCOPe 2.08: d1ayab_
• Chain 'P':
  Compound: peptide pdgfr-1009
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05622 (0-End)
• Chain 'Q':
  Compound: peptide pdgfr-1009
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05622
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ayaA (A:)
  mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
  ydlyggekfatlaelvqyymehhgqlkekngdvielkypln
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ayaB (B:)
  mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
  ydlyggekfatlaelvqyymehhgqlkekngdvielkypln
  

  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.