PDB entry 1aya

View 1aya on RCSB PDB site
Description: crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
Class: hydrolase(sh2 domain)
Keywords: hydrolase(sh2 domain)
Deposited on 1994-05-15, released 1994-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase syp (n-terminal sh2 domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ayaa_
  • Chain 'B':
    Compound: protein-tyrosine phosphatase syp (n-terminal sh2 domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ayab_
  • Chain 'P':
    Compound: peptide pdgfr-1009
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: peptide pdgfr-1009
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayaA (A:)
    mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehhgqlkekngdvielkypln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayaB (B:)
    mrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehhgqlkekngdvielkypln
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.