PDB entry 1ay9

View 1ay9 on RCSB PDB site
Description: wild-type umud' from e. coli
Class: mutagenesis protein
Keywords: mutagenesis protein, DNA repair, hydrolase
Deposited on 1997-11-15, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: umud protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ay9a_
  • Chain 'B':
    Compound: umud protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ay9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ay9A (A:)
    dyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgdiviaavd
    geftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkamr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ay9B (B:)
    dyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgdiviaavd
    geftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkamr