PDB entry 1ay8

View 1ay8 on RCSB PDB site
Description: aromatic amino acid aminotransferase complex with 3-phenylpropionate
Deposited on 1997-11-14, released 1998-10-14
The last revision prior to the SCOP 1.71 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ay8a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ay8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ay8A (A:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ay8B (B:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ay8B (B:)
    mlgnlkpqapdkilalmgefgkidlgvgvykdatghtpimravhaaeqrmletettktya
    glsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrvfvsdpt
    wpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchnptganl
    tldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaascsknfg
    iyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpelradwma
    eleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrikeefgiym
    vgdsriniaglndntipilaraiievgv