PDB entry 1ay7

View 1ay7 on RCSB PDB site
Description: ribonuclease sa complex with barstar
Deposited on 1997-11-14, released 1999-03-02
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ay7a_
  • Chain 'B':
    Domains in SCOP 1.57: d1ay7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ay7A (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ay7B (B:)
kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils