PDB entry 1ay7
View 1ay7 on RCSB PDB site
Description: ribonuclease sa complex with barstar
Class: complex (enzyme/inhibitor)
Keywords: ribonuclease, inhibitor, streptomyces aureofaciens, complex (enzyme/inhibitor)
Deposited on
1997-11-14, released
1999-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.57
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: guanyl-specific ribonuclease sa
Species: Streptomyces aureofaciens [TaxId:1894]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ay7a_ - Chain 'B':
Compound: barstar
Species: Bacillus amyloliquefaciens [TaxId:1390]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ay7b_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ay7A (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ay7B (B:)
kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils