PDB entry 1ay7

View 1ay7 on RCSB PDB site
Description: ribonuclease sa complex with barstar
Class: complex (enzyme/inhibitor)
Keywords: ribonuclease, inhibitor, streptomyces aureofaciens, complex (enzyme/inhibitor)
Deposited on 1997-11-14, released 1999-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • conflict (71)
    Domains in SCOPe 2.08: d1ay7a_
  • Chain 'B':
    Compound: barstar
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ay7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ay7A (A:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhyatfslidqtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ay7B (B:)
    kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegcditiils