PDB entry 1ay5

View 1ay5 on RCSB PDB site
Description: aromatic amino acid aminotransferase complex with maleate
Class: transferase
Keywords: transferase, aminotransferase
Deposited on 1997-11-14, released 1998-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 1998-11-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.171
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aromatic amino acid aminotransferase
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ay5a_
  • Chain 'B':
    Compound: aromatic amino acid aminotransferase
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ay5b_
  • Heterogens: PLP, MAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ay5A (A:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ay5B (B:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ay5B (B:)
    mlgnlkpqapdkilalmgefgkidlgvgvykdatghtpimravhaaeqrmletettktya
    glsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrvfvsdpt
    wpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchnptganl
    tldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaascsknfg
    iyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpelradwma
    eleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrikeefgiym
    vgdsriniaglndntipilaraiievgv