PDB entry 1ay4

View 1ay4 on RCSB PDB site
Description: aromatic amino acid aminotransferase without substrate
Class: transferase
Keywords: transferase, aminotransferase
Deposited on 1997-11-14, released 1998-10-14
The last revision prior to the SCOP 1.75 freeze date was dated 1998-11-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.175
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aromatic amino acid aminotransferase
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ay4a_
  • Chain 'B':
    Compound: aromatic amino acid aminotransferase
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ay4b_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ay4A (A:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ay4B (B:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ay4B (B:)
    mlgnlkpqlalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmletettkty
    aglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrvfvsdp
    twpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchnptgan
    ltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaascsknf
    giyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpelradwm
    aeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrikeefgiy
    mvgdsriniaglndntipilaraiievgv