PDB entry 1ay2

View 1ay2 on RCSB PDB site
Description: structure of the fiber-forming protein pilin at 2.6 angstroms resolution
Class: cell adhesion
Keywords: type IV pilin, fiber-forming protein, membrane protein, DNA inding protein, contractile protein, cell adhesion
Deposited on 1997-11-13, released 1998-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type 4 pilin
    Species: Neisseria gonorrhoeae [TaxId:485]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ay2a_
  • Heterogens: PT, HTO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ay2A (A:)
    ftlielmiviaivgilaavalpayqdytaraqvseaillaegqksavteyylnhgkwpen
    ntsagvasppsdikgkyvkevevkngvvtatmlssgvnneikgkklslwarrengsvkwf
    cgqpvtrtdddtvadakdgkeidtkhlpstcrdnfdak