PDB entry 1ay1

View 1ay1 on RCSB PDB site
Description: anti taq fab tp7
Class: immunoglobulin
Keywords: immunoglobulin, antibody, fab, enzyme inhibitor, pcr, hot start
Deposited on 1997-11-13, released 1998-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: tp7 fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB06744 (1-212)
      • conflict (14)
      • conflict (20)
      • conflict (28)
      • conflict (30)
      • conflict (48)
      • conflict (52)
      • conflict (56)
      • conflict (58)
      • insertion (98-101)
      • conflict (102)
      • insertion (104)
      • conflict (106-107)
      • conflict (113-114)
      • conflict (118)
      • conflict (123)
      • conflict (132)
      • conflict (151)
      • conflict (183)
      • conflict (190-192)
      • conflict (210)
    Domains in SCOPe 2.07: d1ay1h1, d1ay1h2
  • Chain 'L':
    Compound: tp7 fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91W12 (4-209)
      • conflict (16)
      • conflict (20)
      • conflict (30-32)
      • conflict (38)
      • conflict (40)
      • conflict (43)
      • conflict (45)
      • conflict (49-51)
      • conflict (54)
      • conflict (58)
      • conflict (75)
      • conflict (83)
      • conflict (85)
      • conflict (87)
      • conflict (91)
    Domains in SCOPe 2.07: d1ay1l1, d1ay1l2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ay1H (H:)
    evqlqesgpglvkpyqslslsctvtgysitsdyawnwirqfpgnklewmgyitysgttdy
    npslksrisitrdtsknqfflqlnsvttedtatyycaryyygywyfdvwgqgttltvssa
    kttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ay1L (L:)
    diqmtqspaimsaspgekvtmtcsasssvsymywyqqkpgssprlliydstnlasgvpvr
    fsgsgsgtsysltisrmeaedaatyycqqwstypltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnr