PDB entry 1axt

View 1axt on RCSB PDB site
Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes
Class: immunoglobulin
Keywords: immunoglobulin, antibody fab', catalyst, aldolase reaction
Deposited on 1997-10-20, released 1998-10-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin igg2a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1axth1, d1axth2
  • Chain 'L':
    Compound: immunoglobulin igg2a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S16112 (2-215)
      • conflict (32)
      • conflict (36)
      • conflict (38)
      • conflict (44)
      • conflict (50)
      • conflict (54)
      • conflict (93)
      • conflict (107)
    Domains in SCOPe 2.06: d1axtl1, d1axtl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axtH (H:)
    evkleesggglvqpggsmklscvvsgltfsrfwmswvrqspekglewvaeirlksdnyat
    hyaesvkgkftisrddsksrlylqmnslrtedtgiyyckiyfysfsywgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axtL (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsygntflnwylqksgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqgthvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr