PDB entry 1axs

View 1axs on RCSB PDB site
Description: mature oxy-cope catalytic antibody with hapten
Class: catalytic antibody
Keywords: oxy-cope, catalytic antibody, fab fragment
Deposited on 1997-10-20, released 1998-02-04
The last revision prior to the SCOP 1.75 freeze date was dated 1998-02-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxy-cope catalytic antibody
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB21182 (4-210)
      • conflict (10-11)
      • conflict (14)
      • conflict (16)
      • conflict (27)
      • conflict (29-30)
      • conflict (35)
      • conflict (42)
      • conflict (45)
      • conflict (49)
      • conflict (52)
      • conflict (54-55)
      • conflict (68)
      • conflict (70-72)
      • conflict (78-79)
      • conflict (82-84)
      • conflict (90-93)
      • conflict (95)
      • conflict (99)
      • conflict (103)
    Domains in SCOP 1.75: d1axsa1, d1axsa2
  • Chain 'B':
    Compound: oxy-cope catalytic antibody
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1axsb1, d1axsb2
  • Chain 'H':
    Compound: oxy-cope catalytic antibody
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1axsh1, d1axsh2
  • Chain 'L':
    Compound: oxy-cope catalytic antibody
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB21182 (4-210)
      • conflict (10-11)
      • conflict (14)
      • conflict (16)
      • conflict (27)
      • conflict (29-30)
      • conflict (35)
      • conflict (42)
      • conflict (45)
      • conflict (49)
      • conflict (52)
      • conflict (54-55)
      • conflict (68)
      • conflict (70-72)
      • conflict (78-79)
      • conflict (82-84)
      • conflict (90-93)
      • conflict (95)
      • conflict (99)
      • conflict (103)
    Domains in SCOP 1.75: d1axsl1, d1axsl2
  • Heterogens: CD, HOP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsA (A:)
    elvltqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsB (B:)
    qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
    nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsH (H:)
    qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
    nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsL (L:)
    elvltqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr