PDB entry 1axs

View 1axs on RCSB PDB site
Description: mature oxy-cope catalytic antibody with hapten
Deposited on 1997-10-20, released 1998-02-04
The last revision prior to the SCOP 1.69 freeze date was dated 1998-02-04, with a file datestamp of 1998-02-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsA (A:)
    elvltqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsB (B:)
    qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
    nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsH (H:)
    qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
    nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsL (L:)
    elvltqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr