PDB entry 1axs

View 1axs on RCSB PDB site
Description:
Deposited on 1997-10-20, released 1998-02-04
The last revision prior to the SCOP 1.65 freeze date was dated 1998-02-04, with a file datestamp of 1998-02-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1axsa1, d1axsa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1axsb1, d1axsb2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1axsh1, d1axsh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1axsl1, d1axsl2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsA (A:)
    elvltqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsB (B:)
    qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
    nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsH (H:)
    qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
    nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axsL (L:)
    elvltqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr