PDB entry 1axq

View 1axq on RCSB PDB site
Description: ferricyanide oxidized fdi
Class: electron transport
Keywords: electron transport
Deposited on 1997-10-17, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.255
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: FDXA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1axqa_
  • Heterogens: SF4, F3S

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axqA (A:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler