PDB entry 1axm

View 1axm on RCSB PDB site
Description: heparin-linked biologically-active dimer of fibroblast growth factor
Class: growth factor
Keywords: human acidic fibroblast growth factor, heparin decasaccharide, growth factor
Deposited on 1997-10-16, released 1998-04-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: ECGF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • modified residue (61)
    Domains in SCOPe 2.04: d1axma_
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: ECGF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • modified residue (61)
    Domains in SCOPe 2.04: d1axmb_
  • Chain 'C':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: ECGF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • modified residue (61)
    Domains in SCOPe 2.04: d1axmc_
  • Chain 'D':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: ECGF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • modified residue (61)
    Domains in SCOPe 2.04: d1axmd_
  • Chain 'E':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: ECGF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • modified residue (61)
    Domains in SCOPe 2.04: d1axme_
  • Chain 'F':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: ECGF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • modified residue (61)
    Domains in SCOPe 2.04: d1axmf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1axmA (A:)
    gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
    amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
    gqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axmA (A:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1axmB (B:)
    gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
    amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
    gqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axmB (B:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1axmC (C:)
    gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
    amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
    gqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axmC (C:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1axmD (D:)
    gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
    amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
    gqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axmD (D:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1axmE (E:)
    gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
    amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
    gqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axmE (E:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1axmF (F:)
    gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
    amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
    gqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axmF (F:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs