PDB entry 1axj

View 1axj on RCSB PDB site
Description: fmn-binding protein from desulfovibrio vulgaris (miyazaki f), nmr, 20 structures
Deposited on 1997-10-16, released 1998-01-14
The last revision prior to the SCOP 1.71 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1axj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axj_ (-)
    mlpgtffevlknegvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
    dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
    tl