PDB entry 1axj

View 1axj on RCSB PDB site
Description: fmn-binding protein from desulfovibrio vulgaris (miyazaki f), nmr, 20 structures
Class: binding protein
Keywords: fmn-binding protein, binding protein
Deposited on 1997-10-16, released 1998-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fmn-binding protein
  Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q46604 (0-121)
  Domains in SCOPe 2.08: d1axja_
• Heterogens: FMN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1axjA (A:)
  mlpgtffevlknegvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
  dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
  tl