PDB entry 1axi

View 1axi on RCSB PDB site
Description: structural plasticity at the hgh:hghbp interface
Deposited on 1997-10-15, released 1998-01-28
The last revision prior to the SCOP 1.57 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1axiA (A:)
    tiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpqtslcfsesiptps
    nreetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeriq
    tlmgrltdgsprtgqifkqtyskfdtnshnddallknygllycfrrdmtyvatylrivqc
    rsvegscgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axiA (A:)
    tiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpslcfsesiptpsnr
    eetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeriqtl
    mgrltgqifkqtyskfdtallknygllycfrrdmtyvatylrivqcrsvegscgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1axiB (B:)
    epkftkcrsperetfschwtdevhhgtknegpiqlfytrrntqewtqewkecpdyvsage
    nscyfnssftsiaipycikltsnggtvdekcfsvdeivqpdppialnwtllnvsltgiha
    diqvrweaprnadiqkgwmvleyelqykevnetkwkmmdpilttsvpvyslkvdkeyevr
    vrskqrnsgnygefsevlyvtlpqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axiB (B:)
    epkftkcrsperetfschwtdegpiqlfytrrnewkecpdyvsagenscyfnssftsiai
    pycikltsnggtvdekcfsvdeivqpdppialnwtllnvsltgihadiqvrweaprnadi
    qkgwmvleyelqykevnetkwkmmdpilttsvpvyslkvdkeyevrvrskqrnsgnygef
    sevlyvtlpqm