PDB entry 1axi

View 1axi on RCSB PDB site
Description: structural plasticity at the hgh:hghbp interface
Class: complex (hormone/receptor)
Keywords: COMPLEX (HORMONE-RECEPTOR), COMPLEX (HORMONE-RECEPTOR) complex
Deposited on 1997-10-15, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: growth hormone
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01241 (Start-190)
      • engineered (119)
      • conflict (128)
      • engineered (167)
      • engineered (170-171)
      • engineered (173)
      • engineered (175)
    Domains in SCOPe 2.07: d1axia_
  • Chain 'B':
    Compound: growth hormone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10912 (Start-235)
      • conflict (60)
      • engineered (103)
    Domains in SCOPe 2.07: d1axib1, d1axib2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1axiA (A:)
    fptiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpqtslcfsesipt
    psnreetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleer
    iqtlmgrltdgsprtgqifkqtyskfdtnshnddallknygllycfrrdmtyvatylriv
    qcrsvegscgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axiA (A:)
    tiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpslcfsesiptpsnr
    eetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeriqtl
    mgrltgqifkqtyskfdtallknygllycfrrdmtyvatylrivqcrsvegscgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1axiB (B:)
    fsgseataailsrapwslqsvnpglktnssgepkftkcrsperetfschwtdevhhgtkn
    egpiqlfytrrntqewtqewkecpdyvsagenscyfnssftsiaipycikltsnggtvde
    kcfsvdeivqpdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqyke
    vnetkwkmmdpilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlpqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1axiB (B:)
    epkftkcrsperetfschwtdegpiqlfytrrnewkecpdyvsagenscyfnssftsiai
    pycikltsnggtvdekcfsvdeivqpdppialnwtllnvsltgihadiqvrweaprnadi
    qkgwmvleyelqykevnetkwkmmdpilttsvpvyslkvdkeyevrvrskqrnsgnygef
    sevlyvtlpqm