PDB entry 1axh

View 1axh on RCSB PDB site
Description: atracotoxin-hvi from hadronyche versuta (australian funnel-web spider, nmr, 20 structures
Class: neurotoxin
Keywords: neurotoxin, insecticidal toxin, cystine knot, funnel-web
Deposited on 1996-11-04, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: atracotoxin-hvi
  Species: Hadronyche versuta [TaxId:6904]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56207 (0-36)
  Domains in SCOPe 2.08: d1axha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1axhA (A:)
  sptcipsgqpcpynenccsqsctfkenengntvkrcd