PDB entry 1axg

View 1axg on RCSB PDB site
Description: crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution
Class: oxidoreductase
Keywords: oxidoreductase (nad(a)-choh(d)), alcohol dehydrogenase
Deposited on 1997-10-15, released 1998-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene: LADH CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (202)
    Domains in SCOPe 2.06: d1axga1, d1axga2
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene: LADH CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (202)
    Domains in SCOPe 2.06: d1axgb1, d1axgb2
  • Chain 'C':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene: LADH CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (202)
    Domains in SCOPe 2.06: d1axgc1, d1axgc2
  • Chain 'D':
    Compound: alcohol dehydrogenase
    Species: Equus caballus [TaxId:9796]
    Gene: LADH CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (202)
    Domains in SCOPe 2.06: d1axgd1, d1axgd2
  • Heterogens: ZN, NAD, ETF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axgA (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggaglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axgB (B:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggaglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axgC (C:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggaglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axgD (D:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggaglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf