PDB entry 1axd

View 1axd on RCSB PDB site
Description: structure of glutathione s-transferase-I bound with the ligand lactoylglutathione
Class: transferase/transferase inhibitor
Keywords: transferase, herbicide detoxification, transferase-transferase inhibitor complex
Deposited on 1997-10-15, released 1998-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase I
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1axda1, d1axda2
  • Chain 'B':
    Compound: glutathione s-transferase I
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1axdb1, d1axdb2
  • Chain 'C':
    Compound: lactoylglutathione
    Database cross-references and differences (RAF-indexed):
    • PDB 1AXD (0-2)
  • Chain 'D':
    Compound: lactoylglutathione
    Database cross-references and differences (RAF-indexed):
    • PDB 1AXD (0-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1axdA (A:)
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
svldayphvkawwsglmerpsvqkvaalm

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1axdB (B:)
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
svldayphvkawwsglmerpsvqkvaalm

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.