PDB entry 1axa

View 1axa on RCSB PDB site
Description: active-site mobility in human immunodeficiency virus type 1 protease as demonstrated by crystal structure of a28s mutant
Class: aspartyl protease
Keywords: hiv protease, mutant, aspartic protease, hydrolase, acid proteinase, aspartyl protease
Deposited on 1997-10-13, released 1998-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-98)
      • engineered (27)
    Domains in SCOPe 2.08: d1axaa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-98)
      • engineered (27)
    Domains in SCOPe 2.08: d1axab_
  • Heterogens: U0E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axaA (A:)
    pqitlwqrplvtikiggqlkealldtgsddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axaB (B:)
    pqitlwqrplvtikiggqlkealldtgsddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf