PDB entry 1ax8

View 1ax8 on RCSB PDB site
Description: Human obesity protein, leptin
Class: cytokine
Keywords: helical cytokine, hematopoietic factor, diabetes, obesity, cytokine
Deposited on 1997-10-31, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: obesity protein
    Species: Homo sapiens [TaxId:9606]
    Gene: OBESE GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41159 (Start-145)
      • engineered mutation (99)
    Domains in SCOPe 2.07: d1ax8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ax8A (A:)
    vpiqkvqddtktliktivtrindishtqsvsskqkvtgldfipglhpiltlskmdqtlav
    yqqiltsmpsrnviqisndlenlrdllhvlafskschlpeasgletldslggvleasgys
    tevvalsrlqgslqdmlwqldlspgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ax8A (A:)
    iqkvqddtktliktivtrindildfipglhpiltlskmdqtlavyqqiltsmpsrnviqi
    sndlenlrdllhvlafskschlpeasgletldslggvleasgystevvalsrlqgslqdm
    lwqldlspgc