PDB entry 1ax4

View 1ax4 on RCSB PDB site
Description: tryptophanase from proteus vulgaris
Class: tryptophan biosynthesis
Keywords: tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site
Deposited on 1997-10-28, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophanase
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28796
      • modified residue (265)
    Domains in SCOPe 2.07: d1ax4a_
  • Chain 'B':
    Compound: tryptophanase
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28796
      • modified residue (265)
    Domains in SCOPe 2.07: d1ax4b_
  • Chain 'C':
    Compound: tryptophanase
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28796
      • modified residue (265)
    Domains in SCOPe 2.07: d1ax4c_
  • Chain 'D':
    Compound: tryptophanase
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28796
      • modified residue (265)
    Domains in SCOPe 2.07: d1ax4d_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ax4A (A:)
    makrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdh
    qwaamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegk
    aknpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhg
    adnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpk
    yknatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvt
    ygglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdck
    klvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarr
    vytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ax4A (A:)
    akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
    waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
    knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
    dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
    knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
    gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
    lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
    ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ax4B (B:)
    makrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdh
    qwaamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegk
    aknpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhg
    adnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpk
    yknatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvt
    ygglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdck
    klvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarr
    vytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ax4B (B:)
    akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
    waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
    knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
    dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
    knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
    gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
    lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
    ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ax4C (C:)
    makrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdh
    qwaamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegk
    aknpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhg
    adnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpk
    yknatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvt
    ygglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdck
    klvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarr
    vytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ax4C (C:)
    akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
    waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
    knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
    dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
    knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
    gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
    lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
    ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ax4D (D:)
    makrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdh
    qwaamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegk
    aknpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhg
    adnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpk
    yknatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvt
    ygglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdck
    klvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarr
    vytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ax4D (D:)
    akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
    waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
    knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
    dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
    knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
    gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
    lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
    ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpi