PDB entry 1ax3

View 1ax3 on RCSB PDB site
Description: solution nmr structure of b. subtilis iiaglc, 16 structures
Class: phosphotransferase system
Keywords: phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane
Deposited on 1997-10-25, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose permease iia domain
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ax3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ax3A (A:)
    miaeplqneigeevfvspitgeihpitdvpdqvfsgkmmgdgfailpsegivvspvrgki
    lnvfptkhaiglqsdggreilihfgidtvslkgegftsfvsegdrvepgqkllevdldav
    kpnvpslmtpivftnlaegetvsikasgsvnreqedivkiek