PDB entry 1ax1

View 1ax1 on RCSB PDB site
Description: erythrina corallodendron lectin in complex with lactose
Class: lectin
Keywords: lectin, glycoprotein, signal
Deposited on 1997-10-24, released 1998-05-06
The last revision prior to the SCOP 1.73 freeze date was dated 1998-05-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: ERYTHRINA CORALLODENDRON
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ax1a_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ax1A (A:)
    vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
    yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe