PDB entry 1ax1

View 1ax1 on RCSB PDB site
Description: erythrina corallodendron lectin in complex with lactose
Deposited on 1997-10-24, released 1998-05-06
The last revision prior to the SCOP 1.65 freeze date was dated 1998-05-06, with a file datestamp of 1998-05-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1ax1__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ax1_ (-)
    vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlyakpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
    yqtlgvefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilh
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe