PDB entry 1awx

View 1awx on RCSB PDB site
Description: sh3 domain from bruton's tyrosine kinase, nmr, minimized average structure
Deposited on 1997-10-06, released 1998-04-08
The last revision prior to the SCOP 1.57 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1awx__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1awx_ (-)
  gsmstselkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsny
  vteaeds