PDB entry 1awu

View 1awu on RCSB PDB site
Description: cypa complexed with hvgpia (pseudo-symmetric monomer)
Class: complex (isomerase/peptide)
Keywords: complex (isomerase/peptide), cyclophilin a, hiv-1 capsid, pseudo-symmetry
Deposited on 1997-10-05, released 1998-03-18
The last revision prior to the SCOP 1.73 freeze date was dated 1998-03-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.316
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: HOMO SAPIENS
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1awua_
  • Chain 'B':
    Compound: peptide from the hiv-1 capsid protein
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awuA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    No sequence available.