PDB entry 1awp

View 1awp on RCSB PDB site
Description: rat outer mitochondrial membrane cytochrome b5
Deposited on 1997-10-03, released 1998-10-28
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1802
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1awpa_
  • Chain 'B':
    Domains in SCOP 1.55: d1awpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awpA (A:)
    dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeellleqagadatesfed
    lghspdaremlkqyyigdvhpndlkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awpB (B:)
    dpavtyyrleevakrntaeetwmvihgrvyditrflsehpggeellleqagadatesfed
    lghspdaremlkqyyigdvhpndlkp