PDB entry 1awj

View 1awj on RCSB PDB site
Description: intramolecular itk-proline complex, nmr, minimized average structure
Deposited on 1997-10-02, released 1998-01-14
The last revision prior to the SCOP 1.57 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1awj__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1awj_ (-)
  kkplpptpednrrsfqepeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqd
  knghegyapssylveks