PDB entry 1awe

View 1awe on RCSB PDB site
Description: human sos1 pleckstrin homology (ph) domain, nmr, 20 structures
Deposited on 1997-10-01, released 1998-02-25
The last revision prior to the SCOP 1.71 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1awe__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1awe_ (-)
mneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqprlp
gasnaeyrlkekffmrkvqindkddtneykhafeiilkdensvifsaksaeeknnwmaal
islqyrstle