PDB entry 1awe

View 1awe on RCSB PDB site
Description: human sos1 pleckstrin homology (ph) domain, nmr, 20 structures
Class: signal transduction
Keywords: signal transduction, sos, pleckstrin homology (ph) domain
Deposited on 1997-10-01, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sos1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1awea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aweA (A:)
    mneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqprlp
    gasnaeyrlkekffmrkvqindkddtneykhafeiilkdensvifsaksaeeknnwmaal
    islqyrstle