PDB entry 1awd

View 1awd on RCSB PDB site
Description: ferredoxin [2fe-2s] oxidized form from chlorella fusca
Class: electron transport
Keywords: electron transport, eukaryotic, green alga, electron transfer, metalloprotein
Deposited on 1997-10-01, released 1998-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.147
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: 'Chlorella' fusca [TaxId:3073]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1awda_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awdA (A:)
    ykvtlktpsgeetiecpedtyildaaeeagldlpyscragacsscagkvesgevdqsdqs
    flddaqmgkgfvltcvayptsdvtilthqeaaly