PDB entry 1awc

View 1awc on RCSB PDB site
Description: mouse gabp alpha/beta domain bound to DNA
Class: transcription/DNA
Keywords: complex (transcription regulation/DNA), DNA-binding, nuclear protein, ets domain, ankyrin repeats, transcription factor, transcription/DNA complex
Deposited on 1997-10-01, released 1998-03-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.211
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ga binding protein alpha)
    Species: Mus musculus [TaxId:10090]
    Gene: GABP ALPHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1awca_
  • Chain 'B':
    Compound: protein (ga binding protein beta 1)
    Species: Mus musculus [TaxId:10090]
    Gene: GABP BETA 1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1awcb_
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*(bru)p*gp*ap*cp*cp*gp*gp*ap*ap*gp*tp*ap*(cbr)p*ap*cp*(cbr)p*gp*gp*a)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*tp*tp*cp*cp*gp*gp*(bru)p*gp*(bru)p*ap*cp*tp*tp*cp*cp*gp*gp*tp*cp*ap*t)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awcA (A:)
    iqlwqfllelltdkdardciswvgdegefklnqpelvaqkwgqrknkptmnyeklsralr
    yyydgdmickvqgkrfvykfvcdlktligysaaelnrlvieceqkklarm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awcB (B:)
    dlgkklleaaragqddevrilmangapfttdwlgtsplhlaaqyghfsttevllragvsr
    dartkvdrtplhmaaseghanivevllkhgadvnakdmlkmtalhwatehnhqevvelli
    kygadvhtqskfcktafdisidngnedlaeilq
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.