PDB entry 1awb

View 1awb on RCSB PDB site
Description: human myo-inositol monophosphatase in complex with d-inositol-1-phosphate and calcium
Class: hydrolase
Keywords: hydrolase, myo-inositol, phosphatase
Deposited on 1997-10-01, released 1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.153
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myo-inositol monophosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: IMPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1awba_
  • Chain 'B':
    Compound: myo-inositol monophosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: IMPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1awbb_
  • Heterogens: CA, CL, IPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1awbA (A:)
    adpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikek
    ypshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgv
    vyscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmek
    lfcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtgg
    pfdlmsrrviaannrilaeriakeiqviplqrdded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1awbA (A:)
    wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
    hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
    cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
    ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
    lmsrrviaannrilaeriakeiqviplqrdde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1awbB (B:)
    adpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikek
    ypshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgv
    vyscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmek
    lfcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtgg
    pfdlmsrrviaannrilaeriakeiqviplqrdded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1awbB (B:)
    wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
    hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
    cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
    ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
    lmsrrviaannrilaeriakeiqviplqrdde