PDB entry 1aw8

View 1aw8 on RCSB PDB site
Description: pyruvoyl dependent aspartate decarboxylase
Class: decarboxylase
Keywords: decarboxylase, pantothenate pathway, lyase, protein self-processing
Deposited on 1997-10-12, released 1998-04-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-aspartate-alpha-decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1aw8.1
  • Chain 'B':
    Compound: l-aspartate-alpha-decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A790 (0-90)
      • microheterogeneity (0)
      • conflict (0)
    Domains in SCOPe 2.05: d1aw8.1
  • Chain 'D':
    Compound: l-aspartate-alpha-decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1aw8.2
  • Chain 'E':
    Compound: l-aspartate-alpha-decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A790 (0-90)
      • microheterogeneity (0)
      • conflict (0)
    Domains in SCOPe 2.05: d1aw8.2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw8A (A:)
    mirtmlqgklhrvkvthadlhyeg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw8B (B:)
    xcaidqdfldaagileneaidiwnvtngkrfstyaiaaergsriisvngaaahcasvgdi
    viiasfvtmpdeeartwrpnvayfegdnemk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw8D (D:)
    mirtmlqgklhrvkvthadlhyeg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw8E (E:)
    xcaidqdfldaagileneaidiwnvtngkrfstyaiaaergsriisvngaaahcasvgdi
    viiasfvtmpdeeartwrpnvayfegdnemk