PDB entry 1aw8
View 1aw8 on RCSB PDB site
Description: pyruvoyl dependent aspartate decarboxylase
Class: decarboxylase
Keywords: decarboxylase, pantothenate pathway, lyase, protein self-processing
Deposited on
1997-10-12, released
1998-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-01-31, with a file datestamp of
2018-01-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: l-aspartate-alpha-decarboxylase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1aw8.1 - Chain 'B':
Compound: l-aspartate-alpha-decarboxylase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A790 (0-90)
- microheterogeneity (0)
- conflict (0)
Domains in SCOPe 2.08: d1aw8.1 - Chain 'D':
Compound: l-aspartate-alpha-decarboxylase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1aw8.2 - Chain 'E':
Compound: l-aspartate-alpha-decarboxylase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P0A790 (0-90)
- microheterogeneity (0)
- conflict (0)
Domains in SCOPe 2.08: d1aw8.2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1aw8A (A:)
mirtmlqgklhrvkvthadlhyeg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1aw8B (B:)
xcaidqdfldaagileneaidiwnvtngkrfstyaiaaergsriisvngaaahcasvgdi
viiasfvtmpdeeartwrpnvayfegdnemk
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1aw8D (D:)
mirtmlqgklhrvkvthadlhyeg
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1aw8E (E:)
xcaidqdfldaagileneaidiwnvtngkrfstyaiaaergsriisvngaaahcasvgdi
viiasfvtmpdeeartwrpnvayfegdnemk