PDB entry 1aw7

View 1aw7 on RCSB PDB site
Description: q136a mutant of toxic shock syndrome toxin-1 from s. aureus
Class: toxin
Keywords: toxin, superantigen
Deposited on 1997-10-11, released 1998-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.176
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886
      • see remark 999 (115)
      • engineered (135)
    Domains in SCOPe 2.05: d1aw7a1, d1aw7a2
  • Chain 'B':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886
      • see remark 999 (115)
      • engineered (135)
    Domains in SCOPe 2.05: d1aw7b1, d1aw7b2
  • Chain 'C':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886
      • see remark 999 (115)
      • engineered (135)
    Domains in SCOPe 2.05: d1aw7c1, d1aw7c2
  • Chain 'D':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886 (0-193)
      • see remark 999 (115)
      • engineered (135)
    Domains in SCOPe 2.05: d1aw7d1, d1aw7d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw7A (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhaltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw7B (B:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhaltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw7C (C:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhaltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw7D (D:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhaltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein