PDB entry 1aw6

View 1aw6 on RCSB PDB site
Description: gal4 (cd), nmr, 24 structures
Class: transcription regulation
Keywords: transcription regulation, DNA-binding
Deposited on 1997-10-10, released 1998-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gal4 (cd)
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04386 (0-42)
  Domains in SCOPe 2.08: d1aw6a_
• Heterogens: CD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aw6A (A:)
  mkllssieqacdicrlkklkcskekpkcakclknnwecryspk