PDB entry 1aw5

View 1aw5 on RCSB PDB site
Description: 5-aminolevulinate dehydratase from saccharomyces cerevisiae
Deposited on 1997-10-09, released 1998-10-21
The last revision prior to the SCOP 1.65 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1aw5__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw5_ (-)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsa
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgirfir
    ekfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpacyqlppagrglarralerdms
    egadgiivkpstfyldivrdaseickdlpicayhvsgeyamlhaaaekgvvdlktiafes
    hqgflragarliitylapefldwlde