PDB entry 1aw3

View 1aw3 on RCSB PDB site
Description: the solution nmr structure of oxidized rat microsomal cytochrome b5, minimized average structure
Class: electron transport
Keywords: cytochrome b5, protein recognition, electron transport, solution structure, paramagnetic nmr
Deposited on 1997-10-09, released 1998-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aw3a_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw3A (A:)
    dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktyiigelhpddrskiakpsetl