PDB entry 1aw3

View 1aw3 on RCSB PDB site
Description: the solution nmr structure of oxidized rat microsomal cytochrome b5, minimized average structure
Class: electron transport
Keywords: cytochrome b5, protein recognition, electron transport, solution structure, paramagnetic nmr
Deposited on 1997-10-09, released 1998-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00173 (0-93)
  Domains in SCOPe 2.08: d1aw3a_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aw3A (A:)
  dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
  vghstdarelsktyiigelhpddrskiakpsetl