PDB entry 1aw2

View 1aw2 on RCSB PDB site
Description:
Deposited on 1997-10-09, released 1998-01-28
The last revision prior to the SCOP 1.67 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.2
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1aw2a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1aw2b_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1aw2d_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1aw2e_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1aw2g_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1aw2h_
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1aw2j_
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1aw2k_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aw2A (A:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw2A (A:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aw2B (B:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw2B (B:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1aw2D (D:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw2D (D:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeaka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1aw2E (E:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw2E (E:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeak
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1aw2G (G:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw2G (G:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeaka
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1aw2H (H:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw2H (H:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1aw2J (J:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw2J (J:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeaka
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1aw2K (K:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw2K (K:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeak