PDB entry 1aw1

View 1aw1 on RCSB PDB site
Description: triosephosphate isomerase of vibrio marinus complexed with 2-phosphoglycolate
Class: isomerase
Keywords: isomerase, psychrophilic, vibrio marinus
Deposited on 1997-10-09, released 1998-01-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.192
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Moritella marina [TaxId:90736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aw1a_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Moritella marina [TaxId:90736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aw1b_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Moritella marina [TaxId:90736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aw1d_
  • Chain 'E':
    Compound: triosephosphate isomerase
    Species: Moritella marina [TaxId:90736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aw1e_
  • Chain 'G':
    Compound: triosephosphate isomerase
    Species: Moritella marina [TaxId:90736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aw1g_
  • Chain 'H':
    Compound: triosephosphate isomerase
    Species: Moritella marina [TaxId:90736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aw1h_
  • Chain 'J':
    Compound: triosephosphate isomerase
    Species: Moritella marina [TaxId:90736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aw1j_
  • Chain 'K':
    Compound: triosephosphate isomerase
    Species: Moritella marina [TaxId:90736]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1aw1k_
  • Heterogens: PGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aw1A (A:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw1A (A:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aw1B (B:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw1B (B:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1aw1D (D:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw1D (D:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeaka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1aw1E (E:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw1E (E:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeak
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1aw1G (G:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw1G (G:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeaka
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1aw1H (H:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw1H (H:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1aw1J (J:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw1J (J:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeaka
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1aw1K (K:)
    mrhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsa
    iilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflke
    ngltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaa
    taedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaald
    aksfaaiakaaaeaka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aw1K (K:)
    rhpvvmgnwklngskemvvdllnglnaelegvtgvdvavappalfvdlaertlteagsai
    ilgaqntdlnnsgaftgdmspamlkefgathiiighserreyhaesdefvakkfaflken
    gltpvlcigesdaqneagetmavcarqldavintqgvealegaiiayepiwaigtgkaat
    aedaqrihaqirahiaekseavaknvviqyggsvkpenaaayfaqpdidgalvggaalda
    ksfaaiakaaaeak