PDB entry 1aw0

View 1aw0 on RCSB PDB site
Description: fourth metal-binding domain of the menkes copper-transporting ATPase, nmr, 20 structures
Class: hydrolase
Keywords: copper-transporting ATPase, copper-binding domain, hydrolase
Deposited on 1997-10-08, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: menkes copper-transporting ATPase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aw0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw0A (A:)
    ltqetvinidgmtcnscvqsiegviskkpgvksirvslansngtveydplltspetlrga
    iedmgfdatlsd