PDB entry 1avz

View 1avz on RCSB PDB site
Description: v-1 nef protein in complex with wild type fyn sh3 domain
Class: complex (myristylation/transferase)
Keywords: complex (myristylation/transferase), GTP-binding, hiv-1, phosphorylation, nef, sh3 domain, fyn, tyrosine kinase
Deposited on 1997-09-23, released 1998-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.22
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: negative factor
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 NEF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avza_
  • Chain 'B':
    Compound: negative factor
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 NEF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avzb_
  • Chain 'C':
    Compound: fyn tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: FYN TYROSINE KINASE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1avzc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1avzA (A:)
    gsleaqeeeevgfpvtpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiy
    htqgyfpdwqnytpgpgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmdd
    perevlewrfdsrlafhhvarelhpeyfknc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avzA (A:)
    vplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpgpgv
    rypltfgwcyklvpvevlewrfdsrlafhhvarelhpeyf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1avzB (B:)
    gsleaqeeeevgfpvtpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiy
    htqgyfpdwqnytpgpgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmdd
    perevlewrfdsrlafhhvarelhpeyfknc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avzB (B:)
    tpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
    pgvrypltfgwcyklvpvevlewrfdsrlafhhvarelhpeyf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1avzC (C:)
    tlfvalydyearteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv